MENÜLER

Vücudumuzdaki sistem ve dokuların sağlıklı ve düzenli işleyebilmesi için ihtiyaç duyulan besin unsurları, protein, karbonhidrat, yağ, vitaminler, madensel maddeler ve suyun belirli miktarlarda ve en fazla özenle hazırlanmış yemekler bile, gelişigüzel zamanlarda, çeşit ve oranlarına dikkat edilmeksizin, yeterli miktarlardan fazla alınırsa, vücuda istenilen yaran sağlamaz. Bu bakımdan, beslenme ilkeleri, yalnızca, besinleri tanımak ve yiyecek hazırlamada çeşitli kuramsal bilgileri edinmek değil, bu bilgilerin en iyi şekilde uygulanmasını ve yiyecek maddelerinden en iyi şekilde yararlanmabilincine sahip olunmasını gerektirmektedir. Bu nedenle, değişik yiyecek maddelerinin içerdikleri besin unsurlarına ve vücudun günlük ihtiyacına göre, yeterli miktarları ve birbirini tamamlayacak şekilde düzenlenen çeşitleri gözönünde bulundurarak, mönü "yemek listesi" ve öğün "yemek zamanının tespit edilmesine aynı oranda önem verilmelidir.

Öğün Kavramı

İnsanların beslenmelerini bir düzen içinde gerçekleştirmeleri gerekir. Besin maddelerinin yenilme zamanlarındaki belirsizlik ve düzensizlik, yetersiz ve dengesiz beslenmenin ilk nedenlerinden birisidir. Vücudun bu maddelere olan ihtiyacı, açlık dediğimiz olayla anlaşılmaktadır. Açlık, alman besin maddelerinin sindirilmiş olduğu ve yeni besin maddelerine ihtiyaç duyulduğunu bildiren doğal bir işarettir. Bir yönde, öğün kavramı, doğal bir olay. olan açlık duygusu ile belirlenmekte ve çeşitli alışkanlıklarla koşullanmaktadır. Bugün, sindirim organlarının etkinlikleri ve belirli yiyecek maddelerinin sindirilme süreleri etraflıca tespit edilmiştir.

Normal bir insanın, normal koşullar altında, 3-5 saatte proteinli yemekleri, 1-3 saatte karbonhidratlı yemekleri ve 4-6 saatte yağlı yemekleri sindirdiği ve arta kalanı vücuttan attığı anlaşılmıştır. Yemek zamanlarını, ortalama olarak altışar saatlik aralarla tespit etmek mümkündür. Bununla birlikte, yemek zamanlarının belirlenmesinde, çeşitli hayat şartlan ve alışkanlıkların mide salgıları üzerinde etkili olduğu bilinmektedir. Bu konuda önemli olan, yemek saatlerinde düzeni koruma duyarlığıdır.

Görülüyor ki, sindirim fonksiyonunu tamamlayan midenin yeniden çalışmaya hazır olduğunu belirleyen salgılar, açlık duygusunu oluşturmakta ve yemek zamanını belirlemektedir. Ancak, açlık duygusu, her zaman vücudun gerçek besin ihtiyacının bir belirtisi sayılmamalıdır. Zira, çeşitli nedenlerle açlık duygusunun her oluşumunda veya başka sebeplerle, gelişigüzel besin maddelerinin alınması, vücut için gerekli besin unsurları üzerinde durulmasını engelleyecek ve gerçek bir yarar sağlamayacaktır. Düzensiz zamanlarda alınan besin maddeleri, sindirilme imkânı bulmayacağı, dolayısıyla vücuda bir yarar sağlamayacağı gibi, mide ve bağırsakların düzenli çalışmasını engelleyerek de zararlı olur. Yiyeceklerin sin-dirilmemesi halinde besin maddelerinin besleyici özelliklerinden söz edilebilmesi mümkün değildir.

Çeşitli araştırma ve alışkanlıklar, günlük beslenmede üç ana öğün zamanı belirlemiştir. Bunlar, sabah, öğle ve akşam zamanlarıdır. Vücudun günlük beslenme ihtiyacının bütününü, bu üç zaman kesimine bölerek, her zaman kesimi içinde alınacak besin maddelerinin öğün başına düşen miktarı hesaplanabilir. Bununla birlikte, insanların yaşları, cinsleri, özellikleri, günlük etkinlik ve uğraşları göz önünde bulundurularak, sabah, öğle ve akşam öğünlerine düşen besin maddeleri oranı, genel olarak, aşağıdaki şekilde öngörülmüştür:


• Sabah öğünlerinde günlük besin ihtiyacı
• Öğle öğünlerinde %40
• Akşam öğünlerinde %35

Vücudumuzun sağlığı, bütün Öğün zamanlarına gereken önemin verilmesini ve her üç öğün zamanında da, temel besin unsurları içeren yiyecek maddelerinden en az birinin bulundurulmasını zorunlu kılmaktadır. Bir insan vücudu çocukluk, hamilelik, ağır çalışma, diyet gibi özel durumlar dışında, ortalama olarak günde 44 gram protein, 100 gram karbonhidrat, 25 gram yağ, 15 gram tuz, 3 gram potasyum, 600 gram fosfor, 350 gram magnezyum, 9 miligram demir, 200-800 miligram kalsiyum, vücut ağırlığının beher kilosu başına 1 mikrogram iyot, 10-15 miligram çinko ve 2,4 miligram (A) vitamini, 70 miligram (C) vitamini, 0,4 miligram (B,), 0,25-0,5 miligram (B2) vitaminlerine ihtiyaç duyaT. Öte yandan, insan vücudunun ana unsurlarından olan su ihtiyacı-j nın düzenlenmesi ve vücudun su dengesiniö korunması da önem taşır. Vücuttaki 1 gran su buharlaşmasının, 0,6 kalori değer k»v1 na neden olduğu dikkate alınırsa, su il cinin da dikkatle gözetilmesi zorunluğu > taya çıkar. Su ihtiyacı çeşitli şartlarda değ mekle birlikte bunun insan vücudunun günde kaybettiği kadar olduğu anlaşılmış Bu miktar, yine ortalama olarak 1-1,5 olarak hesaplanmaktadır.

Sabah Kahvaltısı

Günlük öğün planı içinde, ilk olarak, önem verilmesi gerekli bir öğün zamanı ol "kahvaltı" adı verilen sabah öğünüyle ı alırız. Gerçekten, sabah alınan besinler nümüzün tümünü etkiler. Akşam öğün den sonra başkaca gıda maddesi almayan cut, sindirim etkinliğini tamamladığı ve ni besin maddeleri için mide salgıları fâ yete başladığı için, sabah öğününün i1 edilmesi halinde, o günün uğraşları için, zırlıksız ve dayanıksız kalacaktır. Kahv; da günlük besin ihtiyacının yukarıda b tildiği üzere %25 tutarında belirli bir tarının alınmaması, diğer öğünlerde b me yüklenmesine de yol açacağından, dun sindirim sistemine baskı yapılması den olacak ve alınan besinlerin vücuı rarlı hale gelmesi engellenecektir. Yani, valtı yapılmaması ya da gelişi güzel bir vahi, ihtiyaç duyulan besin unsurl önemli bir kesimin sağlanamaması açar. Bu takdirde, günün ilerleyen sade, açlık daha çabuk duyulur ve kalori bakımından zengin olmakla birlikte, diğer besin unsurları yönünden noksan yiyeceklerle yetinilir. Bunun sakıncalarına yukarda değinilmiştir. Gerçekte, sabah kahvaltısı, iyi beslenmenin ilk adımıdır. Bu sebeple, kahvaltı alışkanlığını tüm aile fertlerine benimsetmek zorunluluğu mutlaka duyulmalıdır. Sabah kahvaltılarında düşünülebilecek yiyecek maddeleri çok çeşitlidir. Bu çeşitler arasında değişiklikler yaparak, benzer besin unsurlarını sağlama imkânı olduğu gibi, şartlar elvermiyorsa çeşit için zorlanmaya gerek yoktur. İyi bir kahvaltı en az üç gruptaki besin maddelerini kapsamalıdır. Buna göre, geliştirici ve onarıcı besin maddeleri (süt, peynir, yumurta), koruyucu besin maddeleri (meyve, ya da meyve suları) ve enerji veren besin maddeleri (ekmek, tereyağ, reçel) bir kahvaltıda hazır bulundurulabilecek yiyecek maddeleri olarak düşünülebilir. Bir Örnek ermek gerekirse, tereyağ sürülmüş bir dilim ekmek, bir bardak süt, ya da 1 adet yumurta ve yarım portakal veya greyfrut suyu 350 kalori değeri sağlar. Belirli bir kahvaltı sıesi vermeden önce, kahvaltılarda yenilenilecek besin maddelerine topluca bir göz atılmasında yarar vardır.

Bunlar:süt, çay, sütlü çay, limonlu çay, sütlü kahve, kakao, sütlü kakao, ekmek, peksimet,bısküvi, simit, kek, yumurta, beyazpeynir,kaşarpeyniri, zeytin (siyah ya da yeşil), tereyağı (margarin), reçel (marmelât), tahin-ekmez, bal, yoğurt, sucuk, sosis, salam,meyveler-meyve suları, portakal suyu, greyf-suyu, üzüm suyu, domates suyu, ayran,muzlu süttür. Sabah kalvaltılarında, alışkanlıklarımız ne olursa olsun, özellikle, çocukların ve gelişme cağındaki gençlerin süt içme alışkanlığı kazanması sağlamalıdır. Sabah kahvaltında, en mütevazi ya da en fazla imkân Nahip bütçelere göre hazırlanmış olsun,temel besin unsurlarını içeren yiyecek madderinde, ayrıntıya ilişkin yiyecek çeşitleri bulundurmak dışında önemli değişiklikler yoktur

Öğle ve Akşam Yemekleri

Günlük besin gereksinmesinin dörtte biri sabah karşılandığına göre, öğle ve akşam öğünlerinin de dikkatle planlanması zorıınluluğu anlaşılacaktır. Yukarıda öğle yemekle- rinin besin ihtiyacının %40'ını karşılayacak bicimde düzenlenmesi gerektiği belirtilmişti.Bu düşüncenin sebepleri ortadadır; gün-ı. enerjinin gerektirdiği besin unsurlarının !i!unu, en fazla gerek duyulduğu bir anda sağlamak ve vücudun dinlenme zararında sindirim organlarını yormaktan kaçınmak... Ancak, günümüzün hayat şartları,çalışma zorunda olan kimseleri, öğle öğünlerinde genellikle, çalışma yerlerinde sağlanan yiyeceklerle yetinmeleri zorunluğuyla yüz yüze bırakmaktadır. Bu durum göz önünde bulundurularak, beslenme oranlarında değişiklik düşünülebilir ve beslenme dengesinin korunması sağlanabilir. Öğle ve akşam öğünlerinde yemek listesi planlanması, vücudun ihtiyaçları yanında başka etkenler altında da bulunmaktadır.

Bu etkenler:
• Aile bütçesinin imkânları,
• Aile fertlerinin yaş ve cinsiyetleri,
• Aile fertlerinin günlük uğraş ve faaliyetleri,
• Yemek alışkanlıkları,
• Aile fertlerinin istek ve beğenileridir.

Bu etkenler dikkate alınarak, öğle ve akşam öğünleri planlanırken, kabaca, vücudun gereksindiği besin unsurlarının, hangi besin maddelerinin ne kadar miktarda bulunduğu tespit edilmeli ve bu miktar, öğünlere bölünerek yemek listesi hazırlanmalıdır. Öğle ve akşam öğünlerinde, yiyecek maddelerinin içerdikleri besin unsurları yönünden birbirlerini tamamlamalarına dikkat edilmelidir.

Sindirilmesi güç yemeklerin tümü bir öğünde toplanmamak ve öğünler arasında dağıtılmalıdır. Hayvansal besin maddelerinin sindiriminin daha uzun bir süre gerektirdiği göz önünde bulundurulmalı, katı besin maddelerinin sulu besin maddelerine oranla sindiriminin daha uzun sürdüğü unutulmamalıdır. Değişik biçimlerde bile olsa, aynı yiyecek maddesinin başka biçimlerde pişirilmiş çeşitleri, aynı öğünde verilmemelidir. Öğle \e akşam öğünlerinin her birinde, bir sıcak >emek ve çiğnenecek ve sindirim salgılarının çalışmasını sağlayacak besin maddesi bulunmalıdır. Ayrıca, yemek listesi, her öğün çiğ yenebilecek bir yiyecek maddesi içermelidir. Yani, yeşil salata, domates, turp, yeşil soğan, roka. tere. maydanoz, dereotu, pazı ya da kuru soğan, yeşil biber, havuç, marul, salatalık gibi kök sebzeler ya da meyvelerin yenilmesine özen gösterilmelidir. Birinci grupta bulunan yiyecek maddeleri, sabah ve öğle öğünleri listelerinde ana yemek olarak kabul edilmişlerdir. Bu yiyeceklerin her gün iki porsiyonu yemek listelerinde yer almalıdır. Sebze yemeklerine konulan et, çorbalara katılan mercimek, yarım porsiyon olarak kabul edilmektedir. Bir et yemeği, ya da nohut, kuru fasulye gibi yemekler, iki yumurtayla pişirilen bir yemek, bir porsiyon karşılığındadır. Et, balık veya tavukla pişirilen sebze yemekleriyle bir hafta için aile fertlerinin beğenilerine uygun, değişik ve besleyici yemek listeleri düzenlenir.

Yemek listelerinde, üçüncü gruptaki yiyecek maddelerinden de 1-3 porsiyon bulunabilir. Bu gruptaki sebze ve meyvelerden biri ya da birkaçının karışımıyla yemek hazırlanabilir. Orta büyüklükte 1 adet patates, 1 küçük boy kabak, orta büyüklükte bir elma veya portakal, domates, muz bir porsiyon olarak

• Öğle veakşamöğünlerindeyemeklistesininplanlanmasınıvücudunistekleri kadarbaşkaetkenler debelirler. Bütçeimkânları, ailebireylerinin,yaş, cinsiyetvefaaliyetleriyleyemek alışkanlıkları gibi... • Sindirilmesi güç yemeklerin tümünü aynı öğünde toplamamalı. mümkün olduğunca öğünler arasında dağıtılmalıdır. ğuyla yüz yüze bırakmaktadır. Bu durum göz önünde bulundurularak, beslenme oranlarında değişiklik düşünülebilir ve beslenme dengesinin korunması sağlanabilir. Öğle ve akşam öğünlerinde yemek listesi planlanması, vücudun ihtiyaçları yanında başka etkenler altında da bulunmaktadır.

Bu etkenler: • Aile bütçesinin imkânları, • Aile fertlerinin yaş ve cinsiyetleri, • Aile fertlerinin günlük uğraş ve faaliyetleri, • Yemek alışkanlıkları, • Aile fertlerinin istek ve beğenileridir.

Bu etkenler dikkate alınarak, öğle ve akşam öğünleri planlanırken, kabaca, vücudun gereksindiği besin unsurlarının, hangi besin maddelerinin ne kadar miktarda bulunduğu tespit edilmeli ve bu miktar, öğünlere bölünerek yemek listesi hazırlanmalıdır. Öğle ve akşam öğünlerinde, yiyecek maddelerinin içerdikleri besin unsurları yönünden birbirlerini tamamlamalarına dikkat edilmelidir.

Sindirilmesi güç yemeklerin tümü bir öğünde toplanmamak ve öğünler arasında dağıtılmalıdır. Hayvansal besin maddelerinin sindiriminin daha uzun bir süre gerektirdiği göz önünde bulundurulmalı, katı besin maddelerinin sulu besin maddelerine oranla sindiriminin daha uzun sürdüğü unutulmamalıdır. Değişik biçimlerde bile olsa, aynı yiyecek maddesinin başka biçimlerde pişirilmiş çeşitleri, aynı öğünde verilmemelidir. Öğle \e akşam öğünlerinin her birinde, bir sıcak >emek ve çiğnenecek ve sindirim salgılarının çalışmasını sağlayacak besin maddesi bulunmalıdır. Ayrıca, yemek listesi, her öğün çiğ yenebilecek bir yiyecek maddesi içermelidir. Yani, yeşil salata, domates, turp, yeşil soğan, roka. tere. maydanoz, dereotu, pazı ya da kuru soğan, yeşil biber, havuç, marul, salatalık gibi kök sebzeler ya da meyvelerin yenilmesine özen gösterilmelidir. Birinci grupta bulunan yiyecek maddeleri, sabah ve öğle öğünleri listelerinde ana yemek olarak kabul edilmişlerdir. Bu yiyeceklerin her gün iki porsiyonu yemek listelerinde yer almalıdır. Sebze yemeklerine konulan et, çorbalara katılan mercimek, yarım porsiyon olarak kabul edilmektedir. Bir et yemeği, ya da nohut, kuru fasulye gibi yemekler, iki yumurtayla pişirilen bir yemek, bir porsiyon karşılığındadır. Et, balık veya tavukla pişirilen sebze yemekleriyle bir hafta için aile fertlerinin beğenilerine uygun, değişik ve besleyici yemek listeleri düzenlenir.

Yemek listelerinde, üçüncü gruptaki yiyecek maddelerinden de 1-3 porsiyon bulunabilir. Bu gruptaki sebze ve meyvelerden biri ya da birkaçının karışımıyla yemek hazırlanabilir. Orta büyüklükte 1 adet patates, 1 küçük boy kabak, orta büyüklükte bir elma veya portakal, domates, muz bir porsiyon olarakdüşünülmektedir. Kıyılmış sebzelerin bir su bardağı dolusu bir porsiyondur. Ayrıca, dördüncü gruptaki besin maddelerinin herhangi birinden 1-3 porsiyon yenilmelidir. Bir su bardağı dolusu pilav veya makarna, halim tepsi böreği bir porsiyon olarak ele alınır. 1 dilim ekmek, yarım porsiyon olarak kabul edilebilir.

Bu ilkeler dikkate alınarak, bir hafta için öğünlerde aile bireylerine verilecek yemekler ve miktarları önceden tespit edilmeli ve yiyecekler bu ana plana göre sağlanıp, hazır bulundurulmalıdır. Belirli bir haftalık plan yapılmaksızın, her gün ne yemek pişirileceğinin düşünülmesi vç tartışılması, eldeki yiyecek maddelerine göre, gelişigüzel ve gereksiz miktarlarda yemek hazırlanması, öğünlerin geçiştirilmesi sağlıklı beslenme esaslarına aykırıdır. Yemek listeleri, yalnızca haftanın herhangi bir gününde verilecek yemekleri değil, yemeklerin sunulma sıralarını da gösterir. Haftalık yemek listelerini düzenlerken aile bireylerinin de görüşleri ve beğenilerine, isteklerine önem verilmeli, ancak besin grupları içindeki yiyecek maddelerinin ana ilkelere göre sunulmasına özen gösterilmelidir.

Aşağıda, önce bütçe olanaklarını fazla zorlamayacak, sağlıklı bir haftalık yemek listesi örneği veriyoruz. Şüphesiz, bütçe imkânları çok değişik olan aileler için ortak bir yemek listesi düzenlemek oldukça güçtür. Ancak, bu örnek esas alınarak, imkânların elverdiği ölçüde yemek listelerinin değiştirilmesi, ya da çeşitlendirilmesi düşünülebilir.
-------------------------------haftalık yemek listesi -tablo--------------------- Bu haftalık listede dikkat edileceği üzere, l.grup yiyecek maddelerinden 8 servis, 2.grup yiyecek maddelerinden 4 servis 3. grup yiyecek maddelerinden 5 servis ve 4. grup yiyecek maddelerinden de 4 servis yapılması gözönünde bulundurulmuştur. Gruplar arasında denge sağlanabilmesi için de 6 servis çorba, 6 servis salata ve 7 servis meyveye yer verilmiştir. 4 kişilik bir aile için l.grup yiyecek maddelerinden 2,5 kilo et ve 2 kilo balık satın alınmasıyla böyle bir listenin düzenlenmesi gerekeceğine göre, ailenin bütçe imkânları satın almaya yeterli olmadığı takdirde 4.grup yiyecek maddelerine ağırlık verilmesi zorunlu olacaktır. Öte yandan, yemek listeleri üzerinde değişiklik yapılması düşünüldüğünde, 1.gruptaki yiyecek maddelerinden etle, kümes hayvanları arasında yapılacak seçimlerle beslenme dengesi korunabilir. Düzenlenen listede iki hususa ağırlık verildiği anlaşılacaktır. Bunlardan ilki, yiyecek maddelerinin yalnız bir öğün için hazırlanması, diğeri bir önceki öğünde hazırlanan yemekten sonraki öğünde yararlanılabilmeye imkân verecek yemek planlamasıdır. Ailenin gerek maddi ve gerekse zaman şartlan her öğün için yemek hazırlanmasına engel olduğu takdirde, öğle öğünleri için hazırlanan yemeklerdenaK-şam öğünlerinde de yararlanılabılmesinin bir zorunluk olduğu ortaya çıkacaktır. Bu halde, aynı yemeklerin, bir salata eklenmesi, meyvelerde değişiklik yapılması, bir günün öğünleri için pişirilen yemeğin, sonraki günün öğünlerinde de verilmemesine dikkat edilmelidir.
------------------------------yazlık günlük menüler tablo-----------------------
------------------------------kışlık günlük menüler tablo-----------------------

BAYRAM MENÜLERİ
Ramazan Bayramı (1)
  1. Değişik İftariyelikler
  2. Düğün Çorbası
  3. Güveç
  4. Peynirli Puf Böreği
  5. Baklava
Ramazan Bayramı (2)
  1. Değişik İftariyelikler
  2. Etli Bamya
  3. Domatesli Pilav
  4. Güllaç
Kurban Bayramı (1)
  1. Kurban Kavurması
  2. Tereyağlı Pilav
  3. Karışık Salata
  4. Tel Kadayıfı
Kurban Bayramı (2)
  1. Kurban Kavurması
  2. Su Böreği
  3. Karışık Salata
  4. Aşure


-----------------------------davet menüler tablo-----------------------

YAZDIRHepinize ağız tadıyla sağlıklı bir yaşam dileriz.